PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400000368
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family BES1
Protein Properties Length: 555aa    MW: 62206.6 Da    PI: 5.3818
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400000368genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF8221432.8e-44692121134
                DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasas 89 
                           ggs+r ++ +E+E++k+RER+RRai+aki+aGLR++Gny+l++raD+n+V++AL+reAGwvv +DGtt++  s+p+ +  a+g+ +++ 
  PGSC0003DMP400000368  69 GGSRRCRPLEEKERTKLRERQRRAITAKILAGLRRHGNYNLRVRADINDVIAALAREAGWVVLPDGTTFPSRSQPQGTGTAGGTPTTMV 157
                           6899************************************************************************8888888888877 PP

                DUF822  90 pesslq.sslks.........salaspvesysaspksssfpspssldsislasaa 134
                           ++ss++  + ++         s ++   +++++++ks+ +p +s +ds s+a ++
  PGSC0003DMP400000368 158 TSSSSHiPTQHTppgslkdvpSGFQNTDDQSACQMKSVFVPTSSPYDSSSTARSH 212
                           7776653222111111111226677778888899999999999999988776543 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056874.8E-3870202IPR008540BES1/BZR1 plant transcription factor, N-terminal
SuperFamilySSF514451.23E-121252536IPR017853Glycoside hydrolase superfamily
Gene3DG3DSA:3.20.20.804.8E-140255540IPR013781Glycoside hydrolase, catalytic domain
PfamPF013731.5E-79261537IPR001554Glycoside hydrolase, family 14
PRINTSPR007504.6E-41292306IPR001554Glycoside hydrolase, family 14
PRINTSPR007504.6E-41313331IPR001554Glycoside hydrolase, family 14
PRINTSPR007504.6E-41335356IPR001554Glycoside hydrolase, family 14
PRINTSPR007504.6E-41428450IPR001554Glycoside hydrolase, family 14
PRINTSPR007504.6E-41501520IPR001554Glycoside hydrolase, family 14
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000272Biological Processpolysaccharide catabolic process
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048831Biological Processregulation of shoot system development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0016161Molecular Functionbeta-amylase activity
Sequence ? help Back to Top
Protein Sequence    Length: 555 aa     Download sequence    Send to blast
MASEMQRYDT NEDDEEMGMD VKEEDDEDED DEEKNAAMHA IAGFDGVHGS SSSNRFQHHQ  60
QYHEQPTPGG SRRCRPLEEK ERTKLRERQR RAITAKILAG LRRHGNYNLR VRADINDVIA  120
ALAREAGWVV LPDGTTFPSR SQPQGTGTAG GTPTTMVTSS SSHIPTQHTP PGSLKDVPSG  180
FQNTDDQSAC QMKSVFVPTS SPYDSSSTAR SHTSAMVADG LDTQNDPFLV GSVDSIDKQV  240
VDMHTKLQER DFAGTPYIPV YVMLPLGVIN MKSELVDADG LVKQLRVLKS INVDGVMVDC  300
WWGIVEANAP QDYNWNGYKR LFQVVREHKL KIKVVMSFHE CGGNIGDDVC IPLPHWVSEI  360
GRSNPDIYFT DRAGRRNPEC LSWGIDKERV LRSRTAVEVY FDYMRSFRVE FDEFFEDGII  420
SMVEVGLGPC GELRYPSNPV KHGWRYPGVG EFQCYDQYLL KNLRKAAEAR GHSFWARGPD  480
NAGSYNSRPQ ETGFFCDGGD YDGYYGRFFL NWYSQVMIDH ADRVLSLAKL AFDGTCIAAK  540
EFIGGIRQLA MLLN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1bfn_A1e-10425754611299BETA-AMYLASE
1q6c_A1e-10425754611299beta-amylase
1q6g_A1e-10425754611299beta-amylase
1v3i_A1e-10425754611299Beta-amylase
1wdp_A1e-10425754611299Beta-amylase
1wdr_A1e-10425754611299Beta-amylase
1wds_A1e-10425754611299Beta-amylase
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754400.0HG975440.1 Solanum pennellii chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006339564.10.0PREDICTED: beta-amylase 7
RefseqXP_006339565.10.0PREDICTED: beta-amylase 7
RefseqXP_006339566.10.0PREDICTED: beta-amylase 7
SwissprotO808310.0BAM7_ARATH; Beta-amylase 7
TrEMBLM0ZGT80.0M0ZGT8_SOLTU; Beta-amylase
STRINGPGSC0003DMT4000004850.0(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45880.10.0beta-amylase 7
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]